Skip to product information
1 of 1

NSJ Bioreagents

SKU:R32112

CSNK1A1 Antibody

CSNK1A1 Antibody

Regular price $449.00 USD
Regular price Sale price $449.00 USD
Sale Sold out
Shipping calculated at checkout.
Size

Casein kinase I isoform alpha is an enzyme that in humans is encoded by the CSNK1A1 gene. The CSNK1A1 gene is mapped to chromosome 5q32 based on an alignment of the CSNK1A1 sequence with the genomic sequence (GRCh37). It is reported that both screens identified CK1-alpha as a bifunctional regulator of NF-kappa-B. CK1-alpha dynamically associates with the CBM complex on T cell receptor engagement to participate in cytokine production and lymphocyte proliferation. However, CK1-alpha kinase activity has a contrasting role by subsequently promoting the phosphorylation and inactivation of CARMA1. CK1-alpha has thus a dual 'gating' function which first promotes and then terminates receptor-induced NF-kappa-B. ABC DLBCL cells required CK1-alpha for constitutive NF-kappa-B activity, indicating that CK1-alpha functions as a conditionally essential malignancy gene.

Specifications

Family Primary antibody
Formulation 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format Antigen affinity purified
Host Animal Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Species Reactivity Human, Mouse, Rat
Application WB, IHC-P
Application Details Western blot: 0.1-0.5ug/ml,IHC (FFPE): 0.5-1ug/ml
Application Note Optimal dilution of the CSNK1A1 antibody should be determined by the researcher.
Localization Nuclear (CK1alphaL variant), Cytoplasmic (CK1alpha variant)
Immunogen Amino acids DIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQ of human CSNK1A1 were used as the immunogen for the CSNK1A1 antibody.
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
Purity Antigen affinity
Storage After reconstitution, the CSNK1A1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Limitation This CSNK1A1 antibody is available for research use only.
Uniprot # P48729
Status Available
PDF Link https://www.nsjbio.com/tds-pdf/csnk1a1-antibody-r32112
Title CSNK1A1 Antibody
Description Casein kinase I isoform alpha is an enzyme that in humans is encoded by the CSNK1A1 gene. The CSNK1A1 gene is mapped to chromosome 5q32 based on an alignment of the CSNK1A1 sequence with the genomic sequence (GRCh37). It is reported that both screens identified CK1-alpha as a bifunctional regulator of NF-kappa-B. CK1-alpha dynamically associates with the CBM complex on T cell receptor engagement to participate in cytokine production and lymphocyte proliferation. However, CK1-alpha kinase activity has a contrasting role by subsequently promoting the phosphorylation and inactivation of CARMA1. CK1-alpha has thus a dual 'gating' function which first promotes and then terminates receptor-induced NF-kappa-B. ABC DLBCL cells required CK1-alpha for constitutive NF-kappa-B activity, indicating that CK1-alpha functions as a conditionally essential malignancy gene.
View full details