1
/
of
1
NSJ Bioreagents
SKU:R32083
Connexin 45 Antibody
Connexin 45 Antibody
Regular price
$449.00 USD
Regular price
Sale price
$449.00 USD
Unit price
/
per
Shipping calculated at checkout.
Couldn't load pickup availability
Gap junction gamma-1 protein (GJC1), also known as gap junction alpha-7 protein (GJA7) or connexin 45 (Cx45), is a protein that in humans is encoded by the GJC1 gene. The International Radiation Hybrid Mapping Consortium mapped the GJA7 gene to chromosome 17q21.31. This gene is a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell.
Specifications
| Family | Primary antibody |
|---|---|
| Formulation | 0.5mg/ml if reconstituted with 0.2ml sterile DI water |
| Format | Antigen affinity purified |
| Host Animal | Rabbit |
| Clonality | Polyclonal (rabbit origin) |
| Isotype | Rabbit IgG |
| Species Reactivity | Human, Rat |
| Application | WB |
| Application Details | Western blot: 0.1-0.5ug/ml |
| Application Note | Optimal dilution of the Connexin 45 antibody should be determined by the researcher. |
| Immunogen | Amino acids ADLEALQREIRMAQERLDLAVQAYSHQNNP H of human Connexin 45/GJA7 were used as the immunogen for the Connexin 45 antibody. |
| Buffer | Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide |
| Purity | Antigen affinity |
| Storage | After reconstitution, the Connexin 45 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing. |
| Limitation | This Connexin 45 antibody is available for research use only. |
| Uniprot # | P36383 |
| Status | Available |
| PDF Link | https://www.nsjbio.com/tds-pdf/connexin-45-antibody-r32083 |
| Title | Connexin 45 Antibody |
| Description | Gap junction gamma-1 protein (GJC1), also known as gap junction alpha-7 protein (GJA7) or connexin 45 (Cx45), is a protein that in humans is encoded by the GJC1 gene. The International Radiation Hybrid Mapping Consortium mapped the GJA7 gene to chromosome 17q21.31. This gene is a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. |
Share
