Skip to product information
1 of 1

NSJ Bioreagents

SKU:RQ7159

CHTOP Antibody / Chromatin target of PRMT1 protein / C1orf77

CHTOP Antibody / Chromatin target of PRMT1 protein / C1orf77

Regular price $449.00 USD
Regular price Sale price $449.00 USD
Sale Sold out
Shipping calculated at checkout.
Size

This gene encodes a small nuclear protein that is characterized by an arginine and glycine rich region. This protein may have an important role in the regulation of fetal globin gene expression and in the activation of estrogen-responsive genes. A recent study reported that this protein binds 5-hydroxymethylcytosine (5hmC) and associates with an arginine methyltransferase complex (methylosome), which promotes methylation of arginine 3 of histone H4 (H4R3) and activation of genes involved in glioblastomagenesis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.

Specifications

Family Primary antibody
Formulation 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format Antigen affinity purified
Host Animal Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Species Reactivity Human, Mouse, Rat, Monkey
Application WB, IHC-P, FACS
Application Details Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 2-5ug/ml,Flow cytometry: 1-3ug/million cells
Application Note Optimal dilution of the CHTOP antibody should be determined by the researcher.
Localization Nuclear
Immunogen Amino acids AAQSAPKVVLKSTTKMSLNERFTNMLKNKQ were used as the immunogen for the CHTOP antibody.
Buffer Lyophilized from 1X PBS with 2% Trehalose
Purity Antigen affinity purified
Storage After reconstitution, the CHTOP antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Limitation This CHTOP antibody is available for research use only.
Uniprot # Q9Y3Y2
Status Available
PDF Link https://www.nsjbio.com/tds-pdf/chtop-antibody-chromatin-target-of-prmt1-protein-c1orf77-rq7159
Title CHTOP Antibody / Chromatin target of PRMT1 protein / C1orf77
Description This gene encodes a small nuclear protein that is characterized by an arginine and glycine rich region. This protein may have an important role in the regulation of fetal globin gene expression and in the activation of estrogen-responsive genes. A recent study reported that this protein binds 5-hydroxymethylcytosine (5hmC) and associates with an arginine methyltransferase complex (methylosome), which promotes methylation of arginine 3 of histone H4 (H4R3) and activation of genes involved in glioblastomagenesis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
View full details