1
/
of
1
NSJ Bioreagents
SKU:RQ7159
CHTOP Antibody / Chromatin target of PRMT1 protein / C1orf77
CHTOP Antibody / Chromatin target of PRMT1 protein / C1orf77
Regular price
$449.00 USD
Regular price
Sale price
$449.00 USD
Unit price
/
per
Shipping calculated at checkout.
Couldn't load pickup availability
This gene encodes a small nuclear protein that is characterized by an arginine and glycine rich region. This protein may have an important role in the regulation of fetal globin gene expression and in the activation of estrogen-responsive genes. A recent study reported that this protein binds 5-hydroxymethylcytosine (5hmC) and associates with an arginine methyltransferase complex (methylosome), which promotes methylation of arginine 3 of histone H4 (H4R3) and activation of genes involved in glioblastomagenesis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Specifications
| Family | Primary antibody |
|---|---|
| Formulation | 0.5mg/ml if reconstituted with 0.2ml sterile DI water |
| Format | Antigen affinity purified |
| Host Animal | Rabbit |
| Clonality | Polyclonal (rabbit origin) |
| Isotype | Rabbit IgG |
| Species Reactivity | Human, Mouse, Rat, Monkey |
| Application | WB, IHC-P, FACS |
| Application Details | Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 2-5ug/ml,Flow cytometry: 1-3ug/million cells |
| Application Note | Optimal dilution of the CHTOP antibody should be determined by the researcher. |
| Localization | Nuclear |
| Immunogen | Amino acids AAQSAPKVVLKSTTKMSLNERFTNMLKNKQ were used as the immunogen for the CHTOP antibody. |
| Buffer | Lyophilized from 1X PBS with 2% Trehalose |
| Purity | Antigen affinity purified |
| Storage | After reconstitution, the CHTOP antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing. |
| Limitation | This CHTOP antibody is available for research use only. |
| Uniprot # | Q9Y3Y2 |
| Status | Available |
| PDF Link | https://www.nsjbio.com/tds-pdf/chtop-antibody-chromatin-target-of-prmt1-protein-c1orf77-rq7159 |
| Title | CHTOP Antibody / Chromatin target of PRMT1 protein / C1orf77 |
| Description | This gene encodes a small nuclear protein that is characterized by an arginine and glycine rich region. This protein may have an important role in the regulation of fetal globin gene expression and in the activation of estrogen-responsive genes. A recent study reported that this protein binds 5-hydroxymethylcytosine (5hmC) and associates with an arginine methyltransferase complex (methylosome), which promotes methylation of arginine 3 of histone H4 (H4R3) and activation of genes involved in glioblastomagenesis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. |
Share
