1
/
of
1
NSJ Bioreagents
SKU:RQ4650
CD229 Antibody / Ly9
CD229 Antibody / Ly9
Regular price
$449.00 USD
Regular price
Sale price
$449.00 USD
Unit price
/
per
Shipping calculated at checkout.
Couldn't load pickup availability
T-lymphocyte surface antigen Ly-9 is a protein that in humans is encoded by the LY9 gene. This gene is mapped to 17q21.31. LY9 has also recently been designated CD229 (cluster of differentiation 229). LY9 belongs to the SLAM family of immunomodulatory receptors and interacts with the adaptor molecule SAP.
Specifications
| Family | Primary antibody |
|---|---|
| Formulation | 0.5mg/ml if reconstituted with 0.2ml sterile DI water |
| Format | Antigen affinity purified |
| Host Animal | Rabbit |
| Clonality | Polyclonal (rabbit origin) |
| Isotype | Rabbit IgG |
| Species Reactivity | Human, Mouse, Rat |
| Application | IHC-P, FACS |
| Application Details | IHC (FFPE): 1-2ug/ml,FACS: 1-3ug/10^6 cells |
| Application Note | Optimal dilution of the CD229 antibody should be determined by the researcher. |
| Localization | Plasma membrane, cytoplasm |
| Immunogen | Amino acids YKAQINQRNFEVTTEEEFTLFVYEQLQEPQVTMK were used as the immunogen for the CD229 antibody. |
| Buffer | Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide |
| Purity | Antigen affinity purified |
| Storage | After reconstitution, the CD229 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing. |
| Uniprot # | Q9HBG7 |
| Status | Available |
| PDF Link | https://www.nsjbio.com/tds-pdf/cd229-antibody-ly9-rq4650 |
| Title | CD229 Antibody / Ly9 |
| Description | T-lymphocyte surface antigen Ly-9 is a protein that in humans is encoded by the LY9 gene. This gene is mapped to 17q21.31. LY9 has also recently been designated CD229 (cluster of differentiation 229). LY9 belongs to the SLAM family of immunomodulatory receptors and interacts with the adaptor molecule SAP. |
Share
