• Western blot testing of 1) rat liver, 2) mouse liver, 3) human MCF7, 4) human COLO320 and 5) human HeLa lysate with CD133 antibody at 0.5ug/ml. Predicted molecular weight: ~97 kDa (unmodified), ~130 kDa (glycosylated).
1 1

NSJ Bioreagents

R32909

CD133 Antibody (C-Terminal Region)

CD133 Antibody (C-Terminal Region)

$449.00 USD
$449.00 USD
Sale Sold out
Shipping calculated at checkout.
Size

Prominin-1, also known as CD133, is a glycoprotein that in humans is encoded by the PROM1 gene. It is mapped to 4p15.32. Prominin-1 is a member of pentaspan transmembrane glycoproteins (5-transmembrane, 5-TM), which specifically localize to cellular protrusions. This gene encodes a pentaspan transmembrane glycoprotein. The protein localizes to membrane protrusions and is often expressed on adult stem cells, where it is thought to function in maintaining stem cell properties by suppressing differentiation. It has been proposed to act as an organizer of cell membrane topology. Prominin-1 was expressed not only on metastatic colon cancer cells, but also on differentiated colonic epithelium in both adult mice and humans.

Specifications

Family Primary antibody
Formulation 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format Antigen affinity purified
Host Animal Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Species Reactivity Human, Mouse, Rat
Application WB
Application Details Western Blot: 0.5-1ug/ml
Application Note Optimal dilution of the CD133 antibody should be determined by the researcher.
Immunogen Amino acids 808-841 (ALIFAVKLAKYYRRMDSEDVYDDVETIPMKNMEN) were used as the immunogen for the CD133 antibody.
Buffer Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
Purity Antigen affinity
Storage After reconstitution, the CD133 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Limitation This CD133 antibody is available for research use only.
Uniprot # O43490
Status Available
PDF Link https://www.nsjbio.com/tds-pdf/cd133-antibody-c-terminal-region-r32909
Title CD133 Antibody (C-Terminal Region)
Description Prominin-1, also known as CD133, is a glycoprotein that in humans is encoded by the PROM1 gene. It is mapped to 4p15.32. Prominin-1 is a member of pentaspan transmembrane glycoproteins (5-transmembrane, 5-TM), which specifically localize to cellular protrusions. This gene encodes a pentaspan transmembrane glycoprotein. The protein localizes to membrane protrusions and is often expressed on adult stem cells, where it is thought to function in maintaining stem cell properties by suppressing differentiation. It has been proposed to act as an organizer of cell membrane topology. Prominin-1 was expressed not only on metastatic colon cancer cells, but also on differentiated colonic epithelium in both adult mice and humans.
View full details