1
/
of
1
NSJ Bioreagents
SKU:R32687
CD119 Antibody / IFNGR1
CD119 Antibody / IFNGR1
Regular price
$449.00 USD
Regular price
Sale price
$449.00 USD
Unit price
/
per
Shipping calculated at checkout.
Couldn't load pickup availability
Interferon gamma receptor 1 (IFNGR1), also known as CD119 (Cluster of Differentiation 119), is a protein that in humans is encoded by the IFNGR1 gene. This gene encodes the ligand-binding chain (alpha) of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. A genetic variation in IFNGR1 is associated with susceptibility to Helicobacter pylori infection. In addition, defects in IFNGR1 are a cause of mendelian susceptibility to mycobacterial disease, also known as familial disseminated atypical mycobacterial infection.
Specifications
| Family | Primary antibody |
|---|---|
| Formulation | 0.5mg/ml if reconstituted with 0.2ml sterile DI water |
| Format | Antigen affinity purified |
| Host Animal | Rabbit |
| Clonality | Polyclonal (rabbit origin) |
| Isotype | Rabbit IgG |
| Species Reactivity | Human |
| Application | WB, FACS |
| Application Details | Western blot: 0.5-1ug/ml,Flow cytometry: 1-3ug/million cells |
| Application Note | Optimal dilution of the CD119 antibody should be determined by the researcher. |
| Immunogen | Amino acids 108-147 (QKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFH) from the human protein were used as the immunogen for the CD119 antibody. |
| Buffer | Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide |
| Purity | Antigen affinity |
| Storage | After reconstitution, the CD119 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing. |
| Limitation | This CD119 antibody is available for research use only. |
| Uniprot # | P15260 |
| Status | Available |
| PDF Link | https://www.nsjbio.com/tds-pdf/cd119-antibody-ifngr1-r32687 |
| Title | CD119 Antibody / IFNGR1 |
| Description | Interferon gamma receptor 1 (IFNGR1), also known as CD119 (Cluster of Differentiation 119), is a protein that in humans is encoded by the IFNGR1 gene. This gene encodes the ligand-binding chain (alpha) of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. A genetic variation in IFNGR1 is associated with susceptibility to Helicobacter pylori infection. In addition, defects in IFNGR1 are a cause of mendelian susceptibility to mycobacterial disease, also known as familial disseminated atypical mycobacterial infection. |
Share
