Skip to product information
1 of 1

NSJ Bioreagents

SKU:R32392

CCT3 Antibody / TCP1 gamma

CCT3 Antibody / TCP1 gamma

Regular price $449.00 USD
Regular price Sale price $449.00 USD
Sale Sold out
Shipping calculated at checkout.
Size

T-complex protein 1 subunit gamma is a protein that in humans is encoded by the CCT3 gene. The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants have been characterized for this gene. In addition, a pseudogene of this gene has been found on chromosome 8.

Specifications

Family Primary antibody
Formulation 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format Antigen affinity purified
Host Animal Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Species Reactivity Human, Rat
Application WB, FACS, IHC-P, IF/ICC
Application Details Western blot: 0.1-0.5ug/ml,FACS: 1-3ug/10^6 cells,IHC (FFPE): 1-2ug/ml,IF/ICC (FFPE): 2-4ug/ml
Application Note Optimal dilution of the CCT3 antibody should be determined by the researcher.
Localization Cytoplasmic
Immunogen Amino acids EPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQSRQ were used as the immunogen for the CCT3 antibody.
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
Purity Antigen affinity
Storage After reconstitution, the CCT3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Limitation This CCT3 antibody is available for research use only.
Gene ID # 7203.0
Uniprot # P49368
Status Available
PDF Link https://www.nsjbio.com/tds-pdf/cct3-antibody-tcp1-gamma-r32392
Title CCT3 Antibody / TCP1 gamma
Description T-complex protein 1 subunit gamma is a protein that in humans is encoded by the CCT3 gene. The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants have been characterized for this gene. In addition, a pseudogene of this gene has been found on chromosome 8.
View full details