1
/
of
1
NSJ Bioreagents
SKU:R32635
CCS Antibody
CCS Antibody
Regular price
$449.00 USD
Regular price
Sale price
$449.00 USD
Unit price
/
per
Shipping calculated at checkout.
Couldn't load pickup availability
Copper chaperone for superoxide dismutase (CCS, SOD4) is a metalloprotein that is responsible for the delivery of Cu to superoxide dismutase (SOD1). In humans the protein is encoded by the CCS gene. And this gene is mapped to chromosome 11q13 by fluorescence in situ hybridization. The CCS protein is present in mammals and most eukaryotes including yeast. The structure of CCS is composed of three distinct domains that are necessary for its function. Although CCS is important for many organisms, there are CCS independent pathways for SOD1, and many species lack CCS all together, such as C. elegans.
Specifications
| Family | Primary antibody |
|---|---|
| Formulation | 0.5mg/ml if reconstituted with 0.2ml sterile DI water |
| Format | Antigen affinity purified |
| Host Animal | Rabbit |
| Clonality | Polyclonal (rabbit origin) |
| Isotype | Rabbit IgG |
| Species Reactivity | Human, Mouse, Rat |
| Application | WB, IHC-P |
| Application Details | Western blot: 0.5-1ug/ml,IHC (FFPE): 1-2ug/ml |
| Application Note | Optimal dilution of the CCS antibody should be determined by the researcher. |
| Localization | Cytoplasmic, nuclear |
| Immunogen | Amino acids 174-209 (DADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGR) from the human protein were used as the immunogen for the CCS antibody. |
| Buffer | Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide |
| Purity | Antigen affinity |
| Storage | After reconstitution, the CCS antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing. |
| Limitation | This CCS antibody is available for research use only. |
| Uniprot # | O14618 |
| Status | Available |
| PDF Link | https://www.nsjbio.com/tds-pdf/ccs-antibody-r32635 |
| Title | CCS Antibody |
| Description | Copper chaperone for superoxide dismutase (CCS, SOD4) is a metalloprotein that is responsible for the delivery of Cu to superoxide dismutase (SOD1). In humans the protein is encoded by the CCS gene. And this gene is mapped to chromosome 11q13 by fluorescence in situ hybridization. The CCS protein is present in mammals and most eukaryotes including yeast. The structure of CCS is composed of three distinct domains that are necessary for its function. Although CCS is important for many organisms, there are CCS independent pathways for SOD1, and many species lack CCS all together, such as C. elegans. |
Share
