Skip to product information
1 of 1

NSJ Bioreagents

SKU:RQ4145

Carboxypeptidase A Antibody

Carboxypeptidase A Antibody

Regular price $449.00 USD
Regular price Sale price $449.00 USD
Sale Sold out
Shipping calculated at checkout.
Size

Carboxypeptidase A1 is an enzyme that in humans is encoded by the CPA1 gene. This gene encodes a member of the carboxypeptidase A family of zinc metalloproteases. This enzyme is produced in the pancreas and preferentially cleaves C-terminal branched-chain and aromatic amino acids from dietary proteins. This gene and several family members are present in a gene cluster on chromosome 7. Mutations in this gene may be linked to chronic pancreatitis, while elevated protein levels may be associated with pancreatic cancer.

Specifications

Family Primary antibody
Formulation 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format Antigen affinity purified
Host Animal Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Species Reactivity Mouse, Rat
Predicted Species Reactivity Human
Application WB
Application Details Western Blot: 0.5-1ug/ml
Application Note Optimal dilution of the Carboxypeptidase A antibody should be determined by the researcher.
Immunogen Amino acids KRPAIWIDTGIHSREWVTQASGVWFAKKITQDYGQDAAFTAILDTLD from the human protein were used as the immunogen for the Carboxypeptidase A antibody.
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Purity Antigen affinity purified
Storage After reconstitution, the Carboxypeptidase A antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Limitation This Carboxypeptidase A antibody is available for research use only.
Uniprot # P15085
Status Available
PDF Link https://www.nsjbio.com/tds-pdf/carboxypeptidase-a-antibody-rq4145
Title Carboxypeptidase A Antibody
Description Carboxypeptidase A1 is an enzyme that in humans is encoded by the CPA1 gene. This gene encodes a member of the carboxypeptidase A family of zinc metalloproteases. This enzyme is produced in the pancreas and preferentially cleaves C-terminal branched-chain and aromatic amino acids from dietary proteins. This gene and several family members are present in a gene cluster on chromosome 7. Mutations in this gene may be linked to chronic pancreatitis, while elevated protein levels may be associated with pancreatic cancer.
View full details