1
/
of
1
NSJ Bioreagents
SKU:RQ4555
C Reactive Protein Antibody / CRP
C Reactive Protein Antibody / CRP
Regular price
$449.00 USD
Regular price
Sale price
$449.00 USD
Unit price
/
per
Shipping calculated at checkout.
Couldn't load pickup availability
C Reactive Protein (CRP) is a major acute phase reactant synthesized primarily in the liver hepatocytes. It is composed of 5 identical, 21,500-molecular weight subunits. CRP mediates activities associated with preimmune nonspecific host resistance. CRP shows the strongest association with cardiovascular events. It is detectable on the surface of about 4% of normal peripheral blood lymphocytes. Acute phase reactant CRP is produced in the liver.
Specifications
| Family | Primary antibody |
|---|---|
| Formulation | 0.5mg/ml if reconstituted with 0.2ml sterile DI water |
| Format | Antigen affinity purified |
| Host Animal | Rabbit |
| Clonality | Polyclonal (rabbit origin) |
| Isotype | Rabbit IgG |
| Species Reactivity | Human |
| Application | WB, IHC-P |
| Application Details | Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 2-5ug/ml |
| Application Note | Optimal dilution of the C Reactive Protein antibody should be determined by the researcher. |
| Localization | Cytoplasmic, extracellular |
| Immunogen | Amino acids QTDMSRKAFVFPKESDTSYVSLKAPLTKPLKA were used as the immunogen for the C Reactive Protein antibody. |
| Buffer | Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide |
| Purity | Antigen affinity purified |
| Storage | After reconstitution, the C Reactive Protein antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing. |
| Limitation | This C Reactive Protein antibody is available for research use only. |
| Uniprot # | P02741 |
| Status | Available |
| PDF Link | https://www.nsjbio.com/tds-pdf/c-reactive-protein-antibody-crp-rq4555 |
| Title | C Reactive Protein Antibody / CRP |
| Description | C Reactive Protein (CRP) is a major acute phase reactant synthesized primarily in the liver hepatocytes. It is composed of 5 identical, 21,500-molecular weight subunits. CRP mediates activities associated with preimmune nonspecific host resistance. CRP shows the strongest association with cardiovascular events. It is detectable on the surface of about 4% of normal peripheral blood lymphocytes. Acute phase reactant CRP is produced in the liver. |
Share
