1
/
of
1
NSJ Bioreagents
SKU:R31794
Bradykinin Antibody / Kininogen
Bradykinin Antibody / Kininogen
Regular price
$449.00 USD
Regular price
Sale price
$449.00 USD
Unit price
/
per
Shipping calculated at checkout.
Couldn't load pickup availability
Kininogen-1 (KNG1), also known as BDK or bradykinin, is a protein that in humans is encoded by the KNG1 gene. It is mapped to 3q27.3. The KNG1 gene uses alternative splicing to generate two different proteins – high – molecular - weight kininogen (HMWK) and low - molecular- weight kininogen (LMWK). HMWK is essential for blood coagulation and assembly of the kallikrein-kinin system. Also, KNG1, a peptide causing numerous physiological effects, is released from HMWK. In contrast to HMWK, LMWK is not involved in blood coagulation. In addition to that, KNG1 is a constituent of the blood coagulation system as well as the kinin-kallikrein system.
Specifications
| Family | Primary antibody |
|---|---|
| Formulation | 0.5mg/ml if reconstituted with 0.2ml sterile DI water |
| Format | Antigen affinity purified |
| Host Animal | Rabbit |
| Clonality | Polyclonal (rabbit origin) |
| Isotype | Rabbit IgG |
| Species Reactivity | Mouse |
| Application | WB, IHC-P |
| Application Details | Western blot: 0.1-0.5ug/ml,IHC (FFPE): 0.5-1ug/ml |
| Application Note | Optimal dilution of the Bradykinin antibody should be determined by the researcher. |
| Localization | Cytoplasmic |
| Immunogen | Amino acids ECRGNLFMDINNKIANFSQSCTLYSGDDLVEAL of mouse Bradykinin were used as the immunogen for the Bradykinin antibody. |
| Buffer | Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide |
| Purity | Antigen affinity |
| Storage | After reconstitution, the Bradykinin antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing. |
| Limitation | This Bradykinin antibody is available for research use only. |
| Uniprot # | O08677 |
| Status | Available |
| PDF Link | https://www.nsjbio.com/tds-pdf/bradykinin-antibody-kininogen-r31794 |
| Title | Bradykinin Antibody / Kininogen |
| Description | Kininogen-1 (KNG1), also known as BDK or bradykinin, is a protein that in humans is encoded by the KNG1 gene. It is mapped to 3q27.3. The KNG1 gene uses alternative splicing to generate two different proteins – high – molecular - weight kininogen (HMWK) and low - molecular- weight kininogen (LMWK). HMWK is essential for blood coagulation and assembly of the kallikrein-kinin system. Also, KNG1, a peptide causing numerous physiological effects, is released from HMWK. In contrast to HMWK, LMWK is not involved in blood coagulation. In addition to that, KNG1 is a constituent of the blood coagulation system as well as the kinin-kallikrein system. |
Share
