• Western blot testing of 1) human HaCaT, 2) human A431, 3) human A549, 4) human MCF7, 5) rat C6 and 6) mouse Neuro-2a cell lysate with BDKRB2 antibody at 0.5ug/ml. Predicted molecular weight ~44 kDa but may be observed at higher molecular weights due to glycosylation.
1 1

NSJ Bioreagents

R32515

BDKRB2 Antibody / B2 bradykinin receptor

BDKRB2 Antibody / B2 bradykinin receptor

$449.00 USD
$449.00 USD
Sale Sold out
Shipping calculated at checkout.
Size

Bradykinin receptor B2 is a G-protein coupled receptor forbradykinin, encoded by the BDKRB2 gene in humans. This gene encodes a receptor for bradykinin. The 9 aa bradykinin peptide elicits many responses including vasodilation, edema, smooth muscle spasm and pain fiber stimulation. This receptor associates with G proteins that stimulate a phosphatidylinositol-calcium second messenger system. Alternate start codons result in two isoforms of the protein.

Specifications

Family Primary antibody
Formulation 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format Antigen affinity purified
Host Animal Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Species Reactivity Human, Mouse, Rat
Application WB
Application Details Western blot: 0.5-1ug/ml
Application Note Differences in protocols and secondary/substrate sensitivity may require the BDKRB2 antibody to be titrated for optimal performance.
Localization Cytoplasmic, nuclear
Immunogen Amino acids 357-391 (RSEPIQMENSMGTLRTSISVERQIHKLQDWAGSRQ) from the human protein were used as the immunogen for the BDKRB2 antibody.
Buffer Lyophilized from 1X PBS with 2% Trehalose
Purity Antigen affinity
Storage After reconstitution, the BDKRB2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Limitation This BDKRB2 antibody is available for research use only.
Uniprot # P30411
Status Available
PDF Link https://www.nsjbio.com/tds-pdf/bdkrb2-antibody-r32515
Title BDKRB2 Antibody / B2 bradykinin receptor
Description Bradykinin receptor B2 is a G-protein coupled receptor forbradykinin, encoded by the BDKRB2 gene in humans. This gene encodes a receptor for bradykinin. The 9 aa bradykinin peptide elicits many responses including vasodilation, edema, smooth muscle spasm and pain fiber stimulation. This receptor associates with G proteins that stimulate a phosphatidylinositol-calcium second messenger system. Alternate start codons result in two isoforms of the protein.
View full details