Skip to product information
1 of 1

NSJ Bioreagents

SKU:R30157

ATP2A3 Antibody

ATP2A3 Antibody

Regular price $449.00 USD
Regular price Sale price $449.00 USD
Sale Sold out
Shipping calculated at checkout.
Size

Sarcoplasmic/endoplasmic reticulum calcium ATPase 3, also known as SERCA3, is anenzyme that in humans is encoded by the ATP2A3 gene. It is mapped to 17p13.2. This gene encodes one of the SERCA Ca2+-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of cells. ATP2A3 expression was originally described as non-muscular, but was recently observed in cardiomyocyte. What’s more, the expression of ATP2A3 was significantly reduced or lost in colon carcinomas compared with normal colonic epithelial cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in calcium sequestration associated with muscular excitation and contraction.

Specifications

Family Primary antibody
Formulation 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format Antigen affinity purified
Host Animal Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Species Reactivity Human, Mouse, Rat
Application WB, IHC-P
Application Details Western blot: 0.5-1ug/ml,IHC (FFPE): 0.5-1ug/ml
Application Note The stated application concentrations are suggested starting amounts. Titration of the ATP2A3 antibody may be required due to differences in protocols and secondary/substrate sensitivity.
Immunogen An amino acid sequence from the N-terminus of human ATP2A3 (MEAAHLLPAADVLRHFSVTAEGGLSPAQVT) was used as the immunogen for this ATP2A3 antibody.
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
Purity Antigen affinity
Storage After reconstitution, the ATP2A3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Limitation This ATP2A3 antibody is available for research use only.
Status Available
PDF Link https://www.nsjbio.com/tds-pdf/atp2a3-antibody-r30157
Title ATP2A3 Antibody
Description Sarcoplasmic/endoplasmic reticulum calcium ATPase 3, also known as SERCA3, is anenzyme that in humans is encoded by the ATP2A3 gene. It is mapped to 17p13.2. This gene encodes one of the SERCA Ca2+-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of cells. ATP2A3 expression was originally described as non-muscular, but was recently observed in cardiomyocyte. What’s more, the expression of ATP2A3 was significantly reduced or lost in colon carcinomas compared with normal colonic epithelial cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in calcium sequestration associated with muscular excitation and contraction.
View full details