Skip to product information
1 of 1

NSJ Bioreagents

SKU:RQ6040

ATP11C Antibody / Phospholipid-transporting ATPase IG

ATP11C Antibody / Phospholipid-transporting ATPase IG

Regular price $449.00 USD
Regular price Sale price $449.00 USD
Sale Sold out
Shipping calculated at checkout.
Size

ATP11C is an enzyme that in humans is encoded by the ATP11C gene. This gene is mapped to Xq27.1.

Specifications

Family Primary antibody
Formulation 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format Antigen affinity purified
Host Animal Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Species Reactivity Human
Application WB, IF, FACS
Application Details Western blot: 0.5-1ug/ml,Immunofluorescence: 2-4ug/ml,Flow cytometry: 1-3ug/million cells
Application Note Optimal dilution of the ATP11C antibody should be determined by the researcher.
Localization Cytoplasmic, plasma membrane
Immunogen Amino acids QNHEIELTKVHVERNAMDGYRTLCVAFKEIAPDDYER from the human protein were used as the immunogen for the ATP11C antibody.
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Purity Affinity purified
Storage After reconstitution, the ATP11C antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Limitation This ATP11C antibody is available for research use only.
Uniprot # Q8NB49
Status Available
PDF Link https://www.nsjbio.com/tds-pdf/atp11c-antibody-phospholipid-transporting-atpase-ig-rq6040
Title ATP11C Antibody / Phospholipid-transporting ATPase IG
Description ATP11C is an enzyme that in humans is encoded by the ATP11C gene. This gene is mapped to Xq27.1.
View full details