1
/
of
1
NSJ Bioreagents
SKU:R32923
ATOH1 Antibody / MATH1 (N-Terminal Region)
ATOH1 Antibody / MATH1 (N-Terminal Region)
Regular price
$449.00 USD
Regular price
Sale price
$449.00 USD
Unit price
/
per
Shipping calculated at checkout.
Couldn't load pickup availability
Protein atonal homolog 1 is a protein that in humans is encoded by the ATOH1 gene. This protein belongs to the basic helix-loop-helix (BHLH) family of transcription factors. It activates E-box dependent transcription along with E47. ATOH1 is required for the formation of both neural and non-neural cell types. Using genetic deletion in mice, Atoh1 has been shown to be essential for formation of cerebellar granule neurons, inner ear hair cells, spinal cord interneurons, Merkel cells of the skin, and intestinal secretory cells (goblet, enteroendocrine, and Paneth cells).
Specifications
| Family | Primary antibody |
|---|---|
| Formulation | 0.5mg/ml if reconstituted with 0.2ml sterile DI water |
| Format | Antigen affinity purified |
| Host Animal | Rabbit |
| Clonality | Polyclonal (rabbit origin) |
| Isotype | Rabbit IgG |
| Species Reactivity | Human, Rat |
| Application | WB |
| Application Details | Western Blot: 0.5-1ug/ml |
| Application Note | Optimal dilution of the ATOH1 antibody should be determined by the researcher. |
| Immunogen | Amino acids 1-30 (MSRLLHAEEWAEVKELGDHHRQPQPHHLPQ) were used as the immunogen for the ATOH1 antibody. |
| Buffer | Lyophilized from 1X PBS with 2% Trehalose |
| Purity | Antigen affinity |
| Storage | After reconstitution, the ATOH1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing. |
| Limitation | This ATOH1 antibody is available for research use only. |
| Uniprot # | Q92858 |
| Status | Available |
| PDF Link | https://www.nsjbio.com/tds-pdf/atoh1-antibody-math1-n-terminal-region-r32923 |
| Title | ATOH1 Antibody / MATH1 (N-Terminal Region) |
| Description | Protein atonal homolog 1 is a protein that in humans is encoded by the ATOH1 gene. This protein belongs to the basic helix-loop-helix (BHLH) family of transcription factors. It activates E-box dependent transcription along with E47. ATOH1 is required for the formation of both neural and non-neural cell types. Using genetic deletion in mice, Atoh1 has been shown to be essential for formation of cerebellar granule neurons, inner ear hair cells, spinal cord interneurons, Merkel cells of the skin, and intestinal secretory cells (goblet, enteroendocrine, and Paneth cells). |
Share
