Skip to product information
1 of 1

NSJ Bioreagents

SKU:R32923

ATOH1 Antibody / MATH1 (N-Terminal Region)

ATOH1 Antibody / MATH1 (N-Terminal Region)

Regular price $449.00 USD
Regular price Sale price $449.00 USD
Sale Sold out
Shipping calculated at checkout.
Size

Protein atonal homolog 1 is a protein that in humans is encoded by the ATOH1 gene. This protein belongs to the basic helix-loop-helix (BHLH) family of transcription factors. It activates E-box dependent transcription along with E47. ATOH1 is required for the formation of both neural and non-neural cell types. Using genetic deletion in mice, Atoh1 has been shown to be essential for formation of cerebellar granule neurons, inner ear hair cells, spinal cord interneurons, Merkel cells of the skin, and intestinal secretory cells (goblet, enteroendocrine, and Paneth cells).

Specifications

Family Primary antibody
Formulation 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format Antigen affinity purified
Host Animal Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Species Reactivity Human, Rat
Application WB
Application Details Western Blot: 0.5-1ug/ml
Application Note Optimal dilution of the ATOH1 antibody should be determined by the researcher.
Immunogen Amino acids 1-30 (MSRLLHAEEWAEVKELGDHHRQPQPHHLPQ) were used as the immunogen for the ATOH1 antibody.
Buffer Lyophilized from 1X PBS with 2% Trehalose
Purity Antigen affinity
Storage After reconstitution, the ATOH1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Limitation This ATOH1 antibody is available for research use only.
Uniprot # Q92858
Status Available
PDF Link https://www.nsjbio.com/tds-pdf/atoh1-antibody-math1-n-terminal-region-r32923
Title ATOH1 Antibody / MATH1 (N-Terminal Region)
Description Protein atonal homolog 1 is a protein that in humans is encoded by the ATOH1 gene. This protein belongs to the basic helix-loop-helix (BHLH) family of transcription factors. It activates E-box dependent transcription along with E47. ATOH1 is required for the formation of both neural and non-neural cell types. Using genetic deletion in mice, Atoh1 has been shown to be essential for formation of cerebellar granule neurons, inner ear hair cells, spinal cord interneurons, Merkel cells of the skin, and intestinal secretory cells (goblet, enteroendocrine, and Paneth cells).
View full details