NSJ Bioreagents
SKU:R32857
ASL Antibody / Adenylosuccinate Lyase
ASL Antibody / Adenylosuccinate Lyase
Couldn't load pickup availability
ASL (argininosuccinate lyase, also known as argininosuccinase) is an enzyme that catalyzes the reversible breakdown of argininosuccinate (ASA) producing the amino acid arginine and dicarboxylic acid fumarate. Located in liver cytosol, ASL is the fourth enzyme of the urea cycle and involved in the biosynthesis of arginine in all species and the production of urea in ureotelic species. Mutations in ASL, resulting low activity of the enzyme, increase levels of urea in the body and result in various side effects. The ASL gene is located on chromosome 7 between the centromere (junction of the long and short arm) and the long (q) arm at position 11.2, from base pair 64,984,963 to base pair 65,002,090.
Specifications
| Family | Primary antibody |
|---|---|
| Formulation | 0.5mg/ml if reconstituted with 0.2ml sterile DI water |
| Format | Antigen affinity purified |
| Host Animal | Rabbit |
| Clonality | Polyclonal (rabbit origin) |
| Isotype | Rabbit IgG |
| Species Reactivity | Human, Mouse, Rat |
| Application | WB |
| Application Details | Western Blot: 0.5-1ug/ml |
| Application Note | Optimal dilution of the ASL antibody should be determined by the researcher. |
| Localization | Cytoplasmic |
| Immunogen | Amino acids YTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRIN were used as the immunogen for the ASL antibody. |
| Buffer | Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide |
| Purity | Antigen affinity |
| Storage | After reconstitution, the ASL antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing. |
| Limitation | This ASL antibody is available for research use only. |
| Uniprot # | P04424 |
| Status | Available |
| PDF Link | https://www.nsjbio.com/tds-pdf/asl-antibody-adenylosuccinate-lyase-r32857 |
| Title | ASL Antibody / Adenylosuccinate Lyase |
| Description | ASL (argininosuccinate lyase, also known as argininosuccinase) is an enzyme that catalyzes the reversible breakdown of argininosuccinate (ASA) producing the amino acid arginine and dicarboxylic acid fumarate. Located in liver cytosol, ASL is the fourth enzyme of the urea cycle and involved in the biosynthesis of arginine in all species and the production of urea in ureotelic species. Mutations in ASL, resulting low activity of the enzyme, increase levels of urea in the body and result in various side effects. The ASL gene is located on chromosome 7 between the centromere (junction of the long and short arm) and the long (q) arm at position 11.2, from base pair 64,984,963 to base pair 65,002,090. |
Share
