• Western blot testing of 1) rat brain, 2) rat testis, 3) mouse brain, 4) human PANC, 5) human HeLa and 6) human MCF7 lysate with ARC antibody. Expected/observed molecular weight ~45 kDa.
1 1

NSJ Bioreagents

R32271

ARC Antibody / Activity-regulated cytoskeleton-associated protein

ARC Antibody / Activity-regulated cytoskeleton-associated protein

$449.00 USD
$449.00 USD
Sale Sold out
Shipping calculated at checkout.
Size

Arc is widely considered to be an important protein in neurobiology and also a significant tool for systems neuroscience.

Specifications

Family Primary antibody
Formulation 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format Antigen affinity purified
Host Animal Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Species Reactivity Human, Mouse, Rat
Application WB
Application Details Western blot: 0.1-0.5ug/ml
Application Note Optimal dilution of the ARC antibody should be determined by the researcher.
Immunogen Amino acids KLKRFLRHPLPKTLEQLIQRGMEVQDDLEQAAEPA of human ARC were used as the immunogen for the ARC antibody.
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
Purity Antigen affinity
Storage After reconstitution, the ARC antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Limitation This ARC antibody is available for research use only.
Uniprot # Q7LC44
Status Available
PDF Link https://www.nsjbio.com/tds-pdf/arc-antibody-activity-regulated-cytoskeleton-associated-protein-r32271
Title ARC Antibody / Activity-regulated cytoskeleton-associated protein
Description Arc is widely considered to be an important protein in neurobiology and also a significant tool for systems neuroscience.
View full details