• IHC staining of FFPE mouse lung with AQP5 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
1 1

NSJ Bioreagents

RQ4537

AQP5 Antibody / Aquaporin 5

AQP5 Antibody / Aquaporin 5

$449.00 USD
$449.00 USD
Sale Sold out
Shipping calculated at checkout.
Size

Aquaporin 5, also known as AQP5, is a water channel protein. The aquaporins (AQPs) are a family of more than 10 homologous water transporting proteins expressed in many mammalian epithelia and endothelia. At least five AQPs are expressed in the eye: AQP0 (MIP) in lens fiber, AQP1 in cornea endothelium, ciliary and lens epithelia and trabecular meshwork, AQP3 in conjunctiva, AQP4 in ciliary epithelium and retinal M�ller cells, and AQP5 in corneal and lacrimal gland epithelia. Among the seven human aquaporins cloned to date (AQPs 0-6), genes encoding the four most closely related aquaporins (AQP0, AQP2, AQP5, and AQP6) have been mapped to chromosome band 12q13, suggesting an aquaporin family gene cluster at this locus. Aquaporin 5 plays a role in the generation of saliva, tears and pulmonary secretions.

Specifications

Family Primary antibody
Formulation 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format Antigen affinity purified
Host Animal Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Species Reactivity Mouse, Rat
Application WB, IHC-P
Application Details Western blot: 0.5-1ug/ml,IHC (FFPE): 1-2ug/ml
Application Note Optimal dilution of the AQP5 antibody should be determined by the researcher.
Localization Plasma membrane
Immunogen Amino acids NSLSLSERVAIIKGTYEPDEDWEEQREERKKTMELTTR were used as the immunogen for the AQP5 antibody.
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Purity Antigen affinity purified
Storage After reconstitution, the AQP5 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Limitation This AQP5 antibody is available for research use only.
Uniprot # P55064
Status Available
PDF Link https://www.nsjbio.com/tds-pdf/aqp5-antibody-aquaporin-5-rq4537
Title AQP5 Antibody / Aquaporin 5
Description Aquaporin 5, also known as AQP5, is a water channel protein. The aquaporins (AQPs) are a family of more than 10 homologous water transporting proteins expressed in many mammalian epithelia and endothelia. At least five AQPs are expressed in the eye: AQP0 (MIP) in lens fiber, AQP1 in cornea endothelium, ciliary and lens epithelia and trabecular meshwork, AQP3 in conjunctiva, AQP4 in ciliary epithelium and retinal M�ller cells, and AQP5 in corneal and lacrimal gland epithelia. Among the seven human aquaporins cloned to date (AQPs 0-6), genes encoding the four most closely related aquaporins (AQP0, AQP2, AQP5, and AQP6) have been mapped to chromosome band 12q13, suggesting an aquaporin family gene cluster at this locus. Aquaporin 5 plays a role in the generation of saliva, tears and pulmonary secretions.
View full details