• Western blot testing of 1) human U-87 MG, 2) human U-251, 3) rat brain, 4) rat C6, 5) mouse brain and 6) mouse Neuro-2a cell lysate using APH1A antibody. Expected molecular weight: 27~29 kDa.
1 1

NSJ Bioreagents

R32302

APH1A Antibody / Aph-1alpha

APH1A Antibody / Aph-1alpha

$449.00 USD
$449.00 USD
Sale Sold out
Shipping calculated at checkout.
Size

APH1A encodes a component of the gamma secretase complex that cleaves integral membrane proteins such as Notch receptors and beta-amyloid precursor protein. The gamma secretase complex contains this gene product, or the paralogous anterior pharynx defective 1 homolog B (APH1B), along with the presenilin, nicastrin, and presenilin enhancer-2 proteins. The precise function of this seven-transmembrane-domain protein is unknown though it is suspected of facilitating the association of nicastrin and presenilin in the gamma secretase complex as well as interacting with substrates of the gamma secretase complex prior to their proteolytic processing. Polymorphisms in a promoter region of this gene have been associated with an increased risk for developing sporadic Alzheimer's disease. Alternative splicing results in multiple protein-coding and non-protein-coding transcript variants.

Specifications

Family Primary antibody
Formulation 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format Antigen affinity purified
Host Animal Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Species Reactivity Human, Mouse, Rat
Application WB
Application Details Western blot: 0.5-1ug/ml
Application Note Optimal dilution of the APH1A antibody should be determined by the researcher.
Immunogen Amino acids LRSIQRSLLCRRQEDSRVMVYSALRIPPED of human APH1A were used as the immunogen for the APH1A antibody.
Buffer Lyophilized from 1X PBS with 2% Trehalose
Purity Antigen affinity
Storage After reconstitution, the APH1A antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Limitation This APH1A antibody is available for research use only.
Uniprot # Q96BI3
Status Available
PDF Link https://www.nsjbio.com/tds-pdf/aph1a-antibody-aph-1alpha-r32302
Title APH1A Antibody / Aph-1alpha
Description APH1A encodes a component of the gamma secretase complex that cleaves integral membrane proteins such as Notch receptors and beta-amyloid precursor protein. The gamma secretase complex contains this gene product, or the paralogous anterior pharynx defective 1 homolog B (APH1B), along with the presenilin, nicastrin, and presenilin enhancer-2 proteins. The precise function of this seven-transmembrane-domain protein is unknown though it is suspected of facilitating the association of nicastrin and presenilin in the gamma secretase complex as well as interacting with substrates of the gamma secretase complex prior to their proteolytic processing. Polymorphisms in a promoter region of this gene have been associated with an increased risk for developing sporadic Alzheimer's disease. Alternative splicing results in multiple protein-coding and non-protein-coding transcript variants.
View full details