• Western blot testing of human HeLa lysate with APC2 antibody at 0.5ug/ml. N-terminal APC2 antibodies generally show three bands above 200 kDa and may show three degradation or splice variant forms at ~121, 81 and 51 kDa (Ref. 1).
1 1

NSJ Bioreagents

R32509

APC2 Antibody

APC2 Antibody

$449.00 USD
$449.00 USD
Sale Sold out
Shipping calculated at checkout.
Size

APC2, also called APCL or Adenomatous polyposis coli protein-like, is a deduced 2,303-amino acid protein that contains an N-terminal coiled-coil domain, followed by an armadillo domain and five 20-amino acid repeats. The human APC2 gene is mapped to chromosome 19p13.3. It is found that the 20-amino acid repeat domain of APCL could bind beta-catenin (CTNNB1) and deplete the intracellular beta-catenin pool. A reporter gene assay revealed that APCL could regulate interaction of beta-catenin with T cell-specific transcription factors (TCF7), although less efficiently than APC.

Specifications

Family Primary antibody
Formulation 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format Antigen affinity purified
Host Animal Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Species Reactivity Human
Application WB
Application Details Western blot: 0.5-1ug/ml
Application Note Differences in protocols and secondary/substrate sensitivity may require the APC2 antibody to be titrated for optimal performance.
Immunogen Amino acids 51-90 (KHLQGKLEQEARVLVSSGQTEVLEQLKALQMDITSLYNLK) from the human protein were used as the immunogen for the APC2 antibody.
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
Purity Antigen affinity
Storage After reconstitution, the APC2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Limitation This APC2 antibody is available for research use only.
Uniprot # O95996
Status Available
PDF Link https://www.nsjbio.com/tds-pdf/apc2-antibody-r32509
Title APC2 Antibody
Description APC2, also called APCL or Adenomatous polyposis coli protein-like, is a deduced 2,303-amino acid protein that contains an N-terminal coiled-coil domain, followed by an armadillo domain and five 20-amino acid repeats. The human APC2 gene is mapped to chromosome 19p13.3. It is found that the 20-amino acid repeat domain of APCL could bind beta-catenin (CTNNB1) and deplete the intracellular beta-catenin pool. A reporter gene assay revealed that APCL could regulate interaction of beta-catenin with T cell-specific transcription factors (TCF7), although less efficiently than APC.
View full details