1
/
of
1
NSJ Bioreagents
SKU:R32677
Annexin IV Antibody
Annexin IV Antibody
Regular price
$449.00 USD
Regular price
Sale price
$449.00 USD
Unit price
/
per
Shipping calculated at checkout.
Couldn't load pickup availability
ANXA4 (Annexin A4), also known as ANX4, is a protein that in humans is encoded by the ANXA4 gene. It belongs to the annexin family of calcium-dependent phospholipid binding proteins. By PCR analysis of somatic cell hybrids and in situ hybridization with a cDNA probe, the human ANXA4 gene is mapped to chromosome 2p13. Isolated from human placenta, ANXA4 encodes a protein that has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. And ANXA4 is almost exclusively expressed in epithelial cells.
Specifications
| Family | Primary antibody |
|---|---|
| Formulation | 0.5mg/ml if reconstituted with 0.2ml sterile DI water |
| Format | Antigen affinity purified |
| Host Animal | Rabbit |
| Clonality | Polyclonal (rabbit origin) |
| Isotype | Rabbit IgG |
| Species Reactivity | Human, Mouse, Rat |
| Application | WB, IHC-P, FACS |
| Application Details | Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 2-5ug/ml,Flow cytometry: 1-3ug/million cells |
| Application Note | Optimal dilution of the Annexin IV antibody should be determined by the researcher. |
| Localization | Cytoplasm, nucleus, plasma membrane |
| Immunogen | Amino acids 119-152 (EEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVL) from the human protein were used as the immunogen for the Annexin IV antibody. |
| Buffer | Lyophilized from 1X PBS with 2% Trehalose |
| Purity | Antigen affinity |
| Storage | After reconstitution, the Annexin IV antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing. |
| Limitation | This Annexin IV antibody is available for research use only. |
| Uniprot # | P09525 |
| Status | Available |
| PDF Link | https://www.nsjbio.com/tds-pdf/annexin-iv-antibody-r32677 |
| Title | Annexin IV Antibody |
| Description | ANXA4 (Annexin A4), also known as ANX4, is a protein that in humans is encoded by the ANXA4 gene. It belongs to the annexin family of calcium-dependent phospholipid binding proteins. By PCR analysis of somatic cell hybrids and in situ hybridization with a cDNA probe, the human ANXA4 gene is mapped to chromosome 2p13. Isolated from human placenta, ANXA4 encodes a protein that has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. And ANXA4 is almost exclusively expressed in epithelial cells. |
Share
