NSJ Bioreagents
SKU:R31820
AMPK beta 2 Antibody / PRKAB2
AMPK beta 2 Antibody / PRKAB2
Couldn't load pickup availability
5'-AMP-activated protein kinase subunit beta-2 is an enzyme that in humans is encoded by the PRKAB2 gene. The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. It is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit may be a positive regulator of AMPK activity. It is highly expressed in skeletal muscle and thus may have tissue-specific roles. Multiple alternatively spliced transcript variants have been found for this gene.
Specifications
| Family | Primary antibody |
|---|---|
| Formulation | 0.5mg/ml if reconstituted with 0.2ml sterile DI water |
| Format | Antigen affinity purified |
| Host Animal | Rabbit |
| Clonality | Polyclonal (rabbit origin) |
| Isotype | Rabbit IgG |
| Species Reactivity | Human, Mouse, Rat |
| Application | WB, IHC-P, IF, FACS |
| Application Details | Western blot: 0.1-0.5ug/ml,Immunohistochemistry (FFPE): 0.5-1ug/ml,Flow cytometry: 1-3ug/10^6 cells,Immunofluorescence (FFPE): 2-4ug/ml |
| Application Note | Optimal dilution of the PRKAB2 antibody should be determined by the researcher. |
| Localization | Cytoplasmic |
| Immunogen | Amino acids DKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKE of human AMPK beta 2 were used as the immunogen for the PRKAB2 antibody. |
| Buffer | Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide |
| Purity | Antigen affinity |
| Storage | After reconstitution, the PRKAB2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing. |
| Limitation | This PRKAB2 antibody is available for research use only. |
| Uniprot # | O43741 |
| Status | Available |
| PDF Link | https://www.nsjbio.com/tds-pdf/ampk-beta-2-antibody-prkab2-r31820 |
| Title | AMPK beta 2 Antibody / PRKAB2 |
| Description | 5'-AMP-activated protein kinase subunit beta-2 is an enzyme that in humans is encoded by the PRKAB2 gene. The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. It is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit may be a positive regulator of AMPK activity. It is highly expressed in skeletal muscle and thus may have tissue-specific roles. Multiple alternatively spliced transcript variants have been found for this gene. |
Share
