• IHC testing of human pancreatic cancer tissue with Alpha Amylase antibody at 0.5ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
1 1

NSJ Bioreagents

R32663

Alpha Amylase Antibody

Alpha Amylase Antibody

$449.00 USD
$449.00 USD
Sale Sold out
Shipping calculated at checkout.
Size

Amylase is an enzyme that catalyses the breakdown of starch into sugars. Amylase is present in human saliva, where it begins the chemical process of digestion. By in situ hybridization combined with high resolution cytogenetics, the amylase gene is mapped to 1p21. Amylase enzymes find use in bread making and to break down complex sugars such as starch (found in flour) into simple sugars. Yeast then feeds on these simple sugars and converts it into the waste products of alcohol and CO2.

Specifications

Family Primary antibody
Formulation 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format Antigen affinity purified
Host Animal Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Species Reactivity Human, Mouse, Rat
Application WB, IHC-P
Application Details Western blot: 0.5-1ug/ml,IHC (FFPE): 1-2ug/ml
Application Note Optimal dilution of the Alpha Amylase antibody should be determined by the researcher.
Immunogen Amino acids 20-50 (NTQQGRTSIVHLFEWRWVDIALECERYLAPK) from the human protein were used as the immunogen for the Alpha Amylase antibody.
Buffer Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
Purity Antigen affinity
Storage After reconstitution, the Alpha Amylase antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Limitation This Alpha Amylase antibody is available for research use only.
Uniprot # P04745
Status Available
PDF Link https://www.nsjbio.com/tds-pdf/alpha-amylase-antibody-r32663
Title Alpha Amylase Antibody
Description Amylase is an enzyme that catalyses the breakdown of starch into sugars. Amylase is present in human saliva, where it begins the chemical process of digestion. By in situ hybridization combined with high resolution cytogenetics, the amylase gene is mapped to 1p21. Amylase enzymes find use in bread making and to break down complex sugars such as starch (found in flour) into simple sugars. Yeast then feeds on these simple sugars and converts it into the waste products of alcohol and CO2.
View full details