Skip to product information
1 of 1

NSJ Bioreagents

SKU:RQ5956

ALKBH1 Antibody

ALKBH1 Antibody

Regular price $449.00 USD
Regular price Sale price $449.00 USD
Sale Sold out
Shipping calculated at checkout.
Size

Nucleic acid dioxygenase ALKBH1 is an enzyme that in humans is encoded by the ALKBH1 gene. It is mapped to 14q24.3. This gene encodes a homolog to the E. coli alkB gene product. The E. coli alkB protein is part of the adaptive response mechanism of DNA alkylation damage repair. It is involved in damage reversal by oxidative demethylation of 1-methyladenine and 3-methylcytosine.

Specifications

Family Primary antibody
Formulation 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format Antigen affinity purified
Host Animal Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Species Reactivity Human
Application WB, IF
Application Details Western blot: 0.5-1ug/ml,Immunofluorescence: 5ug/ml
Application Note Optimal dilution of the ALKBH1 antibody should be determined by the researcher.
Localization Nuclear, cytoplasmic
Immunogen Amino acids YLKTARVNMTVRQVLATDQNFPLEPIEDEKRD from the human protein were used as the immunogen for the ALKBH1 antibody.
Buffer Lyophilized from 1X PBS with 2% Trehalose
Purity Affinity purified
Storage After reconstitution, the ALKBH1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Limitation This ALKBH1 antibody is available for research use only.
Uniprot # Q13686
Status Available
PDF Link https://www.nsjbio.com/tds-pdf/alkbh1-antibody-rq5956
Title ALKBH1 Antibody
Description Nucleic acid dioxygenase ALKBH1 is an enzyme that in humans is encoded by the ALKBH1 gene. It is mapped to 14q24.3. This gene encodes a homolog to the E. coli alkB gene product. The E. coli alkB protein is part of the adaptive response mechanism of DNA alkylation damage repair. It is involved in damage reversal by oxidative demethylation of 1-methyladenine and 3-methylcytosine.
View full details