• Flow cytometry testing of fixed and permeabilized human HepG2 cells with AKR1D1 antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= AKR1D1 antibody.
1 1

NSJ Bioreagents

RQ4911

AKR1D1 Antibody / Aldo-keto reductase family 1 member D1

AKR1D1 Antibody / Aldo-keto reductase family 1 member D1

$449.00 USD
$449.00 USD
Sale Sold out
Shipping calculated at checkout.
Size

Human delta(4)-3-oxosteroid 5-beta-reductase (steroid 5-beta-reductase) catalyzes 5-beta-reduction of bile acid intermediates and steroid hormones carrying a delta(4)-3-one structure. This gene is mapped to 7q33. The enzyme encoded by this gene is responsible for the catalysis of the 5-beta-reduction of bile acid intermediates and steroid hormones carrying a delta(4)-3-one structure. Deficiency of this enzyme may contribute to hepatic dysfunction. Three transcript variants encoding different isoforms have been found for this gene. Other variants may be present, but their full-length natures have not been determined yet.

Specifications

Family Primary antibody
Formulation 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format Antigen affinity purified
Host Animal Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Species Reactivity Human, Mouse, Rat
Application WB, FACS
Application Details Western blot: 0.5-1ug/ml,FACS: 1-3ug/10^6 cells
Application Note Optimal dilution of the AKR1D1 antibody should be determined by the researcher.
Immunogen Amino acids EEMKDIEALNKNVRFVELLMWRDHPEYPFHDEY from the human protein were used as the immunogen for the AKR1D1 antibody.
Buffer Lyophilized from 1X PBS with 2% Trehalose
Purity Antigen affinity purified
Storage After reconstitution, the AKR1D1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Limitation This AKR1D1 antibody is available for research use only.
Uniprot # P51857
Status Available
PDF Link https://www.nsjbio.com/tds-pdf/akr1d1-antibody-aldo-keto-reductase-family-1-member-d1-rq4911
Title AKR1D1 Antibody / Aldo-keto reductase family 1 member D1
Description Human delta(4)-3-oxosteroid 5-beta-reductase (steroid 5-beta-reductase) catalyzes 5-beta-reduction of bile acid intermediates and steroid hormones carrying a delta(4)-3-one structure. This gene is mapped to 7q33. The enzyme encoded by this gene is responsible for the catalysis of the 5-beta-reduction of bile acid intermediates and steroid hormones carrying a delta(4)-3-one structure. Deficiency of this enzyme may contribute to hepatic dysfunction. Three transcript variants encoding different isoforms have been found for this gene. Other variants may be present, but their full-length natures have not been determined yet.
View full details