• Western blot testing of 1) human PC-3 and 2) mouse lung tissue lysate with AKAP2 antibody at 0.5ug/ml. Predicted molecular weight ~95 kDa (multiple isoforms).
1 1

NSJ Bioreagents

R32805

AKAP2 Antibody / A-kinase anchor protein 2

AKAP2 Antibody / A-kinase anchor protein 2

$449.00 USD
$449.00 USD
Sale Sold out
Shipping calculated at checkout.
Size

A-kinase anchor protein 2 is an enzyme that in humans is encoded by the AKAP2 gene. It is mapped to 9q31.3. The protein encoded by this gene binds to the regulatory subunit of protein kinase A and is found associated with the actin cytoskeleton. The encoded protein mediates signals carried by cAMP and may be involved in creating polarity in certain signaling processes. Three transcript variants encoding different isoforms have been found for this gene.

Specifications

Family Primary antibody
Formulation 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format Antigen affinity purified
Host Animal Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Species Reactivity Human, Mouse
Application WB
Application Details Western blot: 0.5-1ug/ml
Application Note Optimal dilution of the AKAP2 antibody should be determined by the researcher.
Immunogen Amino acids 813-852 (ETHKSKRRERMDDSSVLEATRVNRRKSALALRWEAGIYAN) from the human protein were used as the immunogen for the AKAP2 antibody.
Buffer Lyophilized from 1X PBS with 2% Trehalose
Purity Antigen affinity
Storage After reconstitution, the AKAP2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Limitation This AKAP2 antibody is available for research use only.
Uniprot # Q9Y2D5
Status Available
PDF Link https://www.nsjbio.com/tds-pdf/akap2-antibody-a-kinase-anchor-protein-2-r32805
Title AKAP2 Antibody / A-kinase anchor protein 2
Description A-kinase anchor protein 2 is an enzyme that in humans is encoded by the AKAP2 gene. It is mapped to 9q31.3. The protein encoded by this gene binds to the regulatory subunit of protein kinase A and is found associated with the actin cytoskeleton. The encoded protein mediates signals carried by cAMP and may be involved in creating polarity in certain signaling processes. Three transcript variants encoding different isoforms have been found for this gene.
View full details