1
/
of
1
NSJ Bioreagents
SKU:R32501
AK1 Antibody / Adenylate Kinase 1
AK1 Antibody / Adenylate Kinase 1
Regular price
$449.00 USD
Regular price
Sale price
$449.00 USD
Unit price
/
per
Shipping calculated at checkout.
Couldn't load pickup availability
This gene encodes an adenylate kinase enzyme involved in energy metabolism and homeostasis of cellular adenine nucleotide ratios in different intracellular compartments. This gene is highly expressed in skeletal muscle, brain and erythrocytes. Certain mutations in this gene resulting in a functionally inadequate enzyme are associated with a rare genetic disorder causing nonspherocytic hemolytic anemia. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms.
Specifications
| Family | Primary antibody |
|---|---|
| Formulation | 0.5mg/ml if reconstituted with 0.2ml sterile DI water |
| Format | Antigen affinity purified |
| Host Animal | Rabbit |
| Clonality | Polyclonal (rabbit origin) |
| Isotype | Rabbit IgG |
| Species Reactivity | Human, Mouse, Rat |
| Application | WB, IHC-P, FACS |
| Application Details | Western blot: 0.5-1ug/ml,Immunohistochemistry (FFFPE): 2-5ug/ml,Flow cytometry: 1-3ug/million cells |
| Application Note | Differences in protocols and secondary/substrate sensitivity may require the AK1 antibody to be titrated for optimal performance. |
| Localization | Cytoplasmic |
| Immunogen | Amino acids 149-189 (RLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTH) from the human protein were used as the immunogen for the AK1 antibody. |
| Buffer | Lyophilized from 1X PBS with 2% Trehalose |
| Purity | Antigen affinity |
| Storage | After reconstitution, the AK1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing. |
| Limitation | This AK1 antibody is available for research use only. |
| Uniprot # | P00568 |
| Status | Available |
| PDF Link | https://www.nsjbio.com/tds-pdf/ak1-antibody-adenylate-kinase-1-r32501 |
| Title | AK1 Antibody / Adenylate Kinase 1 |
| Description | This gene encodes an adenylate kinase enzyme involved in energy metabolism and homeostasis of cellular adenine nucleotide ratios in different intracellular compartments. This gene is highly expressed in skeletal muscle, brain and erythrocytes. Certain mutations in this gene resulting in a functionally inadequate enzyme are associated with a rare genetic disorder causing nonspherocytic hemolytic anemia. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms. |
Share
