Skip to product information
1 of 1

NSJ Bioreagents

SKU:R32501

AK1 Antibody / Adenylate Kinase 1

AK1 Antibody / Adenylate Kinase 1

Regular price $449.00 USD
Regular price Sale price $449.00 USD
Sale Sold out
Shipping calculated at checkout.
Size

This gene encodes an adenylate kinase enzyme involved in energy metabolism and homeostasis of cellular adenine nucleotide ratios in different intracellular compartments. This gene is highly expressed in skeletal muscle, brain and erythrocytes. Certain mutations in this gene resulting in a functionally inadequate enzyme are associated with a rare genetic disorder causing nonspherocytic hemolytic anemia. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms.

Specifications

Family Primary antibody
Formulation 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format Antigen affinity purified
Host Animal Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Species Reactivity Human, Mouse, Rat
Application WB, IHC-P, FACS
Application Details Western blot: 0.5-1ug/ml,Immunohistochemistry (FFFPE): 2-5ug/ml,Flow cytometry: 1-3ug/million cells
Application Note Differences in protocols and secondary/substrate sensitivity may require the AK1 antibody to be titrated for optimal performance.
Localization Cytoplasmic
Immunogen Amino acids 149-189 (RLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTH) from the human protein were used as the immunogen for the AK1 antibody.
Buffer Lyophilized from 1X PBS with 2% Trehalose
Purity Antigen affinity
Storage After reconstitution, the AK1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Limitation This AK1 antibody is available for research use only.
Uniprot # P00568
Status Available
PDF Link https://www.nsjbio.com/tds-pdf/ak1-antibody-adenylate-kinase-1-r32501
Title AK1 Antibody / Adenylate Kinase 1
Description This gene encodes an adenylate kinase enzyme involved in energy metabolism and homeostasis of cellular adenine nucleotide ratios in different intracellular compartments. This gene is highly expressed in skeletal muscle, brain and erythrocytes. Certain mutations in this gene resulting in a functionally inadequate enzyme are associated with a rare genetic disorder causing nonspherocytic hemolytic anemia. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms.
View full details