1
/
of
1
NSJ Bioreagents
SKU:R32464
AGO4 Antibody / Argonaute 4
AGO4 Antibody / Argonaute 4
Regular price
$449.00 USD
Regular price
Sale price
$449.00 USD
Unit price
/
per
Shipping calculated at checkout.
Couldn't load pickup availability
AGO4 (Argonaute 4) is also known as EIF2C4. This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic containing PAZ and PIWI domains, and it may play a role in short-interfering-RNA-mediated gene silencing. This gene is located on chromosome 1 in a cluster of closely related family members including argonaute 3, and eukaryotic translation initiation factor 2C, 1.
Specifications
| Family | Primary antibody |
|---|---|
| Formulation | 0.5mg/ml if reconstituted with 0.2ml sterile DI water |
| Format | Antigen affinity purified |
| Host Animal | Rabbit |
| Clonality | Polyclonal (rabbit origin) |
| Isotype | Rabbit IgG |
| Species Reactivity | Human, Rat |
| Application | WB |
| Application Details | Western blot: 0.5-1ug/ml |
| Application Note | Optimal dilution of the AGO4 antibody should be determined by the researcher. |
| Immunogen | Amino acids KDQTFKVSVQWVSVVSLQLLLEALAGHLNEVPDDSVQALD from the human protein were used as the immunogen for the AGO4 antibody. |
| Buffer | Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide |
| Purity | Antigen affinity |
| Storage | Prior to reconstitution, store at 4oC. After reconstitution, the AGO4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing. |
| Limitation | This AGO4 antibody is available for research use only. |
| Uniprot # | Q9HCK5 |
| Status | Available |
| PDF Link | https://www.nsjbio.com/tds-pdf/ago4-antibody-argonaute-4-r32464 |
| Title | AGO4 Antibody / Argonaute 4 |
| Description | AGO4 (Argonaute 4) is also known as EIF2C4. This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic containing PAZ and PIWI domains, and it may play a role in short-interfering-RNA-mediated gene silencing. This gene is located on chromosome 1 in a cluster of closely related family members including argonaute 3, and eukaryotic translation initiation factor 2C, 1. |
Share
