• Western blot testing of 1) human Jurkat, 2) human 293T, 3) human K562, 4) human MCF7, 5) rat lung, 6) rat pancreas and 7) mouse pancreas tissue lysate with AGO2 antibody at 0.5ug/ml. Expected molecular weight ~97 kDa.
1 1

NSJ Bioreagents

R32463

AGO2 Antibody / Argonaute 2

AGO2 Antibody / Argonaute 2

$449.00 USD
$449.00 USD
Sale Sold out
Shipping calculated at checkout.
Size

Protein argonaute-2, also known as AGO2, is a protein that in humans is encoded by the EIF2C2 gene. This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, and contains a PAZ domain and a PIWI domain. It may interact with dicer1 and play a role in short-interfering-RNA-mediated gene silencing. Multiple transcript variants encoding different isoforms have been found for this gene.

Specifications

Family Primary antibody
Formulation 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format Antigen affinity purified
Host Animal Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Species Reactivity Human, Mouse, Rat
Application WB
Application Details Western blot: 0.5-1ug/ml
Application Note Optimal dilution of the AGO2 antibody should be determined by the researcher.
Immunogen Amino acids KVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRHL from the human protein were used as the immunogen for the AGO2 antibody.
Buffer Lyophilized from 1X PBS with 2% Trehalose
Purity Antigen affinity
Storage Prior to reconstitution, store at 4oC. After reconstitution, the AGO2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Limitation This AGO2 antibody is available for research use only.
Uniprot # Q9UKV8
Status Available
PDF Link https://www.nsjbio.com/tds-pdf/ago2-antibody-argonaute-2-r32463
Title AGO2 Antibody / Argonaute 2
Description Protein argonaute-2, also known as AGO2, is a protein that in humans is encoded by the EIF2C2 gene. This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, and contains a PAZ domain and a PIWI domain. It may interact with dicer1 and play a role in short-interfering-RNA-mediated gene silencing. Multiple transcript variants encoding different isoforms have been found for this gene.
View full details