• Western blot testing of human 1) HeLa, 2) HepG2, 3) Caco-2, 4) HEK293, 5) MDA-MB-453, 6) PANC-1 and 7) SW620 cell lysate with AFF4 antibody. Predicted molecular weight ~127/98/39 kDa (isoforms 1/2/3).
1 1

NSJ Bioreagents

RQ6288

AFF4 Antibody

AFF4 Antibody

$449.00 USD
$449.00 USD
Sale Sold out
Shipping calculated at checkout.
Size

The AFF4 gene encodes a scaffold protein that functions as a core component of the super elongation complex (SEC), which is involved in transcriptional regulation during embryogenesis. The protein encoded by this gene belongs to the AF4 family of transcription factors involved in leukemia. It is a component of the positive transcription elongation factor b (P-TEFb) complex. This gene is mapped to chromosome 5q31.

Specifications

Family Primary antibody
Formulation 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format Antigen affinity purified
Clone 8G12
Host Animal Mouse
Clonality Monoclonal (mouse origin)
Isotype Mouse IgG2b
Species Reactivity Human
Application WB, FACS
Application Details Western blot: 1-2ug/ml,Flow cytometry: 1-3ug/million cells
Application Note Optimal dilution of the AFF4 antibody should be determined by the researcher.
Immunogen Amino acids RNVLRMKERERRNQEIQQGEDAFPPSSPLFAEPYKVTSKEDKLSSRIQ from the human protein were used as the immunogen for the AFF4 antibody.
Buffer Lyophilized from 1X PBS with 2% Trehalose
Purity Affinity purified
Storage After reconstitution, the AFF4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Limitation This AFF4 antibody is available for research use only.
Uniprot # Q9UHB7
Status Available
PDF Link https://www.nsjbio.com/tds-pdf/aff4-antibody-8g12-rq6288
Title AFF4 Antibody
Description The AFF4 gene encodes a scaffold protein that functions as a core component of the super elongation complex (SEC), which is involved in transcriptional regulation during embryogenesis. The protein encoded by this gene belongs to the AF4 family of transcription factors involved in leukemia. It is a component of the positive transcription elongation factor b (P-TEFb) complex. This gene is mapped to chromosome 5q31.
View full details