• Western blot testing of 1) human HeLa, 2) human U-87 MG, 3) human Jurkat, 4) human HepG2, 5) rat brain, 6) rat skeletal muscle, 7) mouse brain and 8) mouse skeletal muscle tissue lysate with Aconitase 2 antibody. Predicted molecular weight: ~85 kDa.
1 1

NSJ Bioreagents

R32458

Aconitase 2 Antibody / ACO2

Aconitase 2 Antibody / ACO2

$449.00 USD
$449.00 USD
Sale Sold out
Shipping calculated at checkout.
Size

Aconitase 2, mitochondrial is a protein that in humans is encoded by the ACO2 gene. The protein encoded by this gene belongs to the aconitase/IPM isomerase family. It is an enzyme that catalyzes the interconversion of citrate to isocitrate via cis-aconitate in the second step of the TCA cycle. This protein is encoded in the nucleus and functions in the mitochondrion. It was found to be one of the mitochondrial matrix proteins that are preferentially degraded by the serine protease 15 (PRSS15), also known as Lon protease, after oxidative modification.

Specifications

Family Primary antibody
Formulation 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Format Antigen affinity purified
Host Animal Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Species Reactivity Human, Mouse, Rat
Application WB
Application Details Western blot: 0.5-1ug/ml
Application Note Optimal dilution of the Aconitase 2 antibody should be determined by the researcher.
Localization Cytoplasmic
Immunogen Amino acids TSQRLQLLEPFDKWDGKDLEDLQILIKVKGKCTTDH from the human protein were used as the immunogen for the Aconitase 2 antibody.
Buffer Lyophilized from 1X PBS with 2% Trehalose
Purity Antigen affinity
Storage Prior to reconstitution, store at 4oC. After reconstitution, the Aconitase 2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Limitation This Aconitase 2 antibody is available for research use only.
Uniprot # Q99798
Status Available
PDF Link https://www.nsjbio.com/tds-pdf/aconitase-2-antibody-aco2-r32458
Title Aconitase 2 Antibody / ACO2
Description Aconitase 2, mitochondrial is a protein that in humans is encoded by the ACO2 gene. The protein encoded by this gene belongs to the aconitase/IPM isomerase family. It is an enzyme that catalyzes the interconversion of citrate to isocitrate via cis-aconitate in the second step of the TCA cycle. This protein is encoded in the nucleus and functions in the mitochondrion. It was found to be one of the mitochondrial matrix proteins that are preferentially degraded by the serine protease 15 (PRSS15), also known as Lon protease, after oxidative modification.
View full details