NSJ Bioreagents
SKU:RQ4007
Ace Antibody / Angiotensin I converting enzyme
Ace Antibody / Angiotensin I converting enzyme
Couldn't load pickup availability
Angiotensin I converting enzyme (ACE), also called DCP or CD143 is a zinc-containing dipeptidyl carboxypeptidase widely distributed in mammalian tissues and is thought to play a critical role in blood pressure regulation. This gene is mapped to 17q23.3. This gene encodes an enzyme involved in catalyzing the conversion of angiotensin I into a physiologically active peptide angiotensin II. Angiotensin II is a potent vasopressor and aldosterone-stimulating peptide that controls blood pressure and fluid-electrolyte balance. This enzyme plays a key role in the renin-angiotensin system. Many studies have associated the presence or absence of a 287 bp Alu repeat element in this gene with the levels of circulating enzyme or cardiovascular pathophysiologies.
Specifications
| Family | Primary antibody |
|---|---|
| Formulation | 0.5mg/ml if reconstituted with 0.2ml sterile DI water |
| Format | Antigen affinity purified |
| Host Animal | Rabbit |
| Clonality | Polyclonal (rabbit origin) |
| Isotype | Rabbit IgG |
| Species Reactivity | Mouse, Rat |
| Application | WB, IHC-P, FACS |
| Application Details | Western Blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 2-5ug/ml,Flow cytometry: 1-3ug/million cells |
| Application Note | Optimal dilution of the Ace antibody should be determined by the researcher. |
| Immunogen | Amino acids AMMNYFKPLTEWLVTENRRHGETLGWPEYNWAPNTAR from the mouse protein were used as the immunogen for the Ace antibody. |
| Buffer | Lyophilized from 1X PBS with 2% Trehalose |
| Purity | Antigen affinity purified |
| Storage | After reconstitution, the Ace antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing. |
| Limitation | This Ace antibody is available for research use only. |
| Uniprot # | P09470 |
| Status | Available |
| PDF Link | https://www.nsjbio.com/tds-pdf/ace-antibody-angiotensin-i-converting-enzyme-rq4007 |
| Title | Ace Antibody / Angiotensin I converting enzyme |
| Description | Angiotensin I converting enzyme (ACE), also called DCP or CD143 is a zinc-containing dipeptidyl carboxypeptidase widely distributed in mammalian tissues and is thought to play a critical role in blood pressure regulation. This gene is mapped to 17q23.3. This gene encodes an enzyme involved in catalyzing the conversion of angiotensin I into a physiologically active peptide angiotensin II. Angiotensin II is a potent vasopressor and aldosterone-stimulating peptide that controls blood pressure and fluid-electrolyte balance. This enzyme plays a key role in the renin-angiotensin system. Many studies have associated the presence or absence of a 287 bp Alu repeat element in this gene with the levels of circulating enzyme or cardiovascular pathophysiologies. |
Share
