1
/
of
1
NSJ Bioreagents
SKU:R32457
ABR Antibody / Active BCR related
ABR Antibody / Active BCR related
Regular price
$449.00 USD
Regular price
Sale price
$449.00 USD
Unit price
/
per
Shipping calculated at checkout.
Couldn't load pickup availability
This ABR gene encodes a protein that is similar to the protein encoded by the breakpoint cluster region gene located on chromosome 22. The protein encoded by this gene contains a GTPase-activating protein domain, a domain found in members of the Rho family of GTP-binding proteins. Functional studies in mice determined that this protein plays a role in vestibular morphogenesis. Alternatively spliced transcript variants have been reported for this gene.
Specifications
| Family | Primary antibody |
|---|---|
| Formulation | 0.5mg/ml if reconstituted with 0.2ml sterile DI water |
| Format | Antigen affinity purified |
| Host Animal | Rabbit |
| Clonality | Polyclonal (rabbit origin) |
| Isotype | Rabbit IgG |
| Species Reactivity | Human, Mouse, Rat |
| Application | WB, IHC-P |
| Application Details | Western blot: 0.5-1ug/ml,IHC (FFPE): 1-2ug/ml |
| Application Note | Optimal dilution of the ABR antibody should be determined by the researcher. |
| Localization | Cytoplasmic, membranous |
| Immunogen | Amino acids HPFPDHELEDMKMKISALKSEIQKEKANKGQSRAIERL from the human protein were used as the immunogen for the ABR antibody. |
| Buffer | Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide |
| Purity | Antigen affinity |
| Storage | Prior to reconstitution, store at 4oC. After reconstitution, the ABR antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing. |
| Limitation | This ABR antibody is available for research use only. |
| Uniprot # | Q12979 |
| Status | Available |
| PDF Link | https://www.nsjbio.com/tds-pdf/abr-antibody-active-bcr-related-r32457 |
| Title | ABR Antibody / Active BCR related |
| Description | This ABR gene encodes a protein that is similar to the protein encoded by the breakpoint cluster region gene located on chromosome 22. The protein encoded by this gene contains a GTPase-activating protein domain, a domain found in members of the Rho family of GTP-binding proteins. Functional studies in mice determined that this protein plays a role in vestibular morphogenesis. Alternatively spliced transcript variants have been reported for this gene. |
Share
