Skip to product information
1 of 1

AntibodySystem

SKU:RGK26103

Anti-Twin-Strep-tag Antibody (SAA0348)

Anti-Twin-Strep-tag Antibody (SAA0348)

Regular price $220.00 USD
Regular price Sale price $220.00 USD
Sale Sold out
Shipping calculated at checkout.
Title

Catalog No.: RGK26103

Catalog No. RGK26103
Product name Anti-Twin-Strep-tag Antibody (SAA0348)
Size 100 μg
Species reactivity General
Host species Mouse
Isotype IgG2b
Applications ELISA, WB
Form Liquid
Storage buffer 100 mM Pro-Ac, 20 mM Arg, pH 5.0
Purity >95% as determined by SDS-PAGE.
Clonality Monoclonal
Target Twin-Strep-tag, Twin Strep tag, TwinStrep tag,Streptag,Strep tag, SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK
Purification Protein A/G purified from cell culture supernatant.
Endotoxin level Please contact with the lab for this information.
Stability and Storage Use a manual defrost freezer and avoid repeated freeze-thaw cycles. Store at 4°C short term (1-2 weeks). Store at -20°C 12 months. Store at -80°C long term.
Clone ID SAA0348
Note For research use only.
View full details