{"product_id":"new-product-118250","title":"Recombinant Swine CXCL13 protein(N-His)","description":"Introducing the Recombinant Swine CXCL13 protein (N-His), a meticulously engineered product that showcases exceptional quality and efficacy. This protein, derived from swine sources, has been produced using advanced recombinant technology, ensuring its purity and reliability.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eThe Recombinant Swine CXCL13 protein (N-His) is a valuable tool for researchers and scientists in the field of immunology. With its high affinity for the CXCR5 receptor, this protein plays a crucial role in the regulation of B cell migration and homing. Its ability to induce chemotaxis in B cells makes it an indispensable component in studies related to immune response and inflammation.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eCrafted with utmost precision, this protein is characterized by its N-terminal histidine tag (N-His), which facilitates easy purification and detection. Its recombinant nature ensures consistency and reproducibility, making it an ideal choice for experimental procedures and assays.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eThe Recombinant Swine CXCL13 protein (N-His) is supplied in a lyophilized form, ensuring long-term stability and ease of storage. Each vial contains a generous amount of protein, allowing for multiple experiments and reducing the need for frequent reordering.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eWe take pride in offering this exceptional product, backed by our commitment to quality and customer satisfaction. With the Recombinant Swine CXCL13 protein (N-His), researchers can delve deeper into the intricate mechanisms of immune response, paving the way for groundbreaking discoveries and advancements in the field of immunology.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eNote: This product is intended for research purposes only and is not suitable for diagnostic or therapeutic applications.","brand":"Elabscience","offers":[{"title":"20µg \/ MRFTLGSLLLVLLLACSLFPIHGVLETNDTNLKCQCLRSTSNWVPIRLIEKIQIWPPGNGCPTREVIVWMTNKTAICLNPQSKLLQKLINLMWRKKTSTTLPAPVSKKSIA \/ N-His","offer_id":47618075132184,"sku":"PKSS000023","price":495.0,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0590\/5652\/1400\/products\/Elabscience_logo_d5907149-bd0b-4b46-b5d8-d6ce50db6377.png?v=1706721414","url":"https:\/\/danabiosci.com\/products\/new-product-118250","provider":"Dana Bioscience","version":"1.0","type":"link"}