{"product_id":"new-product-118247","title":"Recombinant Swine IGF-I protein(N-His)","description":"Introducing the Recombinant Swine IGF-I protein(N-His), a high-quality protein product that has been meticulously developed to meet the needs of the scientific community. This protein is derived from swine and has been produced using recombinant DNA technology, ensuring its purity and consistency. The N-His tag on the protein allows for easy purification and detection, making it an ideal choice for research and development purposes. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eThe Recombinant Swine IGF-I protein(N-His) is a potent growth factor that plays a crucial role in cell proliferation, differentiation, and survival. It has been extensively studied and has been shown to have a wide range of applications in various fields, including biotechnology, pharmaceuticals, and agriculture. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eOur product is manufactured under strict quality control measures to ensure its purity, potency, and stability. It is supplied in lyophilized form, making it easy to store and transport. The Recombinant Swine IGF-I protein(N-His) is available in various quantities to meet the diverse needs of our customers. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eIn conclusion, the Recombinant Swine IGF-I protein(N-His) is a high-quality protein product that offers exceptional purity, consistency, and potency. It is an ideal choice for researchers and scientists who require a reliable and effective growth factor for their studies. We are confident that our product will meet and exceed your expectations, and we look forward to serving you.","brand":"Elabscience","offers":[{"title":"20µg \/ MGKISSLPTQLFKCCFCDFLKVKMHITSSSHLFYLALCLLSFTSSATAGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKAQKEVHLKNTSRGSSGNKNYRM \/ N-His","offer_id":47618073690392,"sku":"PKSS000020","price":495.0,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0590\/5652\/1400\/products\/Elabscience_logo_aad323f8-2a67-45c9-9aee-9d923e9c6b2c.png?v=1706721404","url":"https:\/\/danabiosci.com\/products\/new-product-118247","provider":"Dana Bioscience","version":"1.0","type":"link"}