{"product_id":"new-product-118241","title":"Recombinant Swine IFN gamma protein(N-His)(active)","description":"Introducing the Recombinant Swine IFN gamma protein(N-His)(active), a highly effective and potent protein that is designed to enhance the immune response in swine. This protein is produced using advanced recombinant technology, ensuring its purity and activity. It contains a histidine tag at the N-terminus, which facilitates its purification and detection. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eThe Recombinant Swine IFN gamma protein(N-His)(active) is a crucial component in the development of vaccines and immunotherapies for swine. It plays a vital role in the activation of macrophages and natural killer cells, which are essential in the defense against viral and bacterial infections. This protein is also involved in the regulation of the immune response, ensuring that it is balanced and effective. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eOur Recombinant Swine IFN gamma protein(N-His)(active) is of the highest quality, and its activity has been extensively tested. It is available in various quantities to meet the needs of different applications. This protein is suitable for research purposes, as well as for use in the biopharmaceutical industry. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eIn summary, the Recombinant Swine IFN gamma protein(N-His)(active) is a reliable and effective protein that is essential in the development of vaccines and immunotherapies for swine. Its purity, activity, and quality make it an ideal choice for researchers and biopharmaceutical companies alike.","brand":"Elabscience","offers":[{"title":"20µg \/ MSYTTYFLAFQLCVTLCFSGSYCQAPFFKEITILKDYFNASTSDVPNGGPLFLEILKNWKEESDKKIIQSQIVSFYFKFFEIFKDNQAIQRSMDVIKQDMFQRFLNGSSGKLNDFEKLIKIPVDNLQIQRKAISELIKVMNDLSPRSNLRKRKRSQTMFQGQRASK \/ N-His","offer_id":47618059206936,"sku":"PKSS000012","price":495.0,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0590\/5652\/1400\/products\/Elabscience_logo_e30297bc-96f7-43fb-917e-ab6033e439d3.png?v=1706721381","url":"https:\/\/danabiosci.com\/products\/new-product-118241","provider":"Dana Bioscience","version":"1.0","type":"link"}